PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P18760_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 756aa    MW: 82513.1 Da    PI: 6.101
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P18760_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.8e-21109164156
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            +++ +++t+ q++eLe+lF+++++p++++r eL+k+l+L++rqVk+WFqNrR+++k
  GSMUA_Achr1P18760_001 109 KKRYHRHTPLQIQELEALFKECPHPDEKQRLELSKRLNLETRQVKFWFQNRRTQMK 164
                            688999***********************************************999 PP

2START191.44.3e-602784992205
                            HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S. CS
                  START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla. 77 
                            la+ a++elv +a+ eep+Wv ss    e +n + +l++f +  +       + +ea+r +gvv+ ++  lve+l+d + +W  +++ 
  GSMUA_Achr1P18760_001 278 LALVAMEELVNMAQMEEPLWVPSSdggtETLNHEQYLRTFRRISGtgmppvgYASEASRQKGVVIINSLALVETLMDAR-RWADMFPc 364
                            67889***********************************775559*********************************.******** PP

                            ...EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEE CS
                  START  78 ...kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgilie 155
                               ka+t+evis g      galqlm aelq+lsplv+ R+++f+R+++q+ +g+w++vdvSvds +      s++ +++lpSg++++
  GSMUA_Achr1P18760_001 365 iiaKATTMEVISGGvggtrdGALQLMHAELQVLSPLVAvREVYFLRFCKQHAEGVWAVVDVSVDSIRASF---SSASCRRLPSGCVVQ 449
                            ********************************************************************65...5677778******** PP

                            EECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                  START 156 pksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                            +++ g+skvtwveh+++++ ++h+l+r+l++sgla+ga +wvatlqrqce
  GSMUA_Achr1P18760_001 450 DMPSGYSKVTWVEHAEYEEGQVHQLYRPLLRSGLAFGAGRWVATLQRQCE 499
                            *************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-2197160IPR009057Homeodomain-like
SuperFamilySSF466899.61E-2198166IPR009057Homeodomain-like
PROSITE profilePS5007117.75106166IPR001356Homeobox domain
SMARTSM003891.9E-19107170IPR001356Homeobox domain
PfamPF000461.4E-18109164IPR001356Homeobox domain
CDDcd000861.27E-19109166No hitNo description
PROSITE patternPS000270141164IPR017970Homeobox, conserved site
PROSITE profilePS5084842.172268503IPR002913START domain
SuperFamilySSF559618.79E-31272500No hitNo description
CDDcd088751.30E-113272499No hitNo description
SMARTSM002345.6E-44277500IPR002913START domain
PfamPF018522.5E-51278499IPR002913START domain
SuperFamilySSF559612.42E-17522722No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 756 aa     Download sequence    Send to blast
MSFGGLSDGR SGALPYGKAA MTTGELSPPE FISQRLPKPS FVSPGLSLGL VKKTDPCIID  60
TSRMAAVGGG SDVDSAKRNK EDENDSRSES DNLEAISGDD TDQVNPRKKK RYHRHTPLQI  120
QELEALFKEC PHPDEKQRLE LSKRLNLETR QVKFWFQNRR TQMKTQIERH ENSILRQEND  180
KLRAENMAIR EAARNPVCNS CGGPAMLADI SMEEQQLRIE NARLKEELDR VCALAGKFLG  240
KSISSLSEPI SPSMRSSVLE LGVGNNGFLG ERSMHLELAL VAMEELVNMA QMEEPLWVPS  300
SDGGTETLNH EQYLRTFRRI SGTGMPPVGY ASEASRQKGV VIINSLALVE TLMDARRWAD  360
MFPCIIAKAT TMEVISGGVG GTRDGALQLM HAELQVLSPL VAVREVYFLR FCKQHAEGVW  420
AVVDVSVDSI RASFSSASCR RLPSGCVVQD MPSGYSKVTW VEHAEYEEGQ VHQLYRPLLR  480
SGLAFGAGRW VATLQRQCEG LAILMSSAIT ARDETETITA SGRRSMLKLA QRMTNAFCAG  540
VCTSSAQEWS KLATENVGDE VRVMTRMSVN EPGEPAGVVL SAATSVWIPE SPKRLFDFLR  600
EASFRSKWDI LSNGAPMYEM AHIAKGQDAG NAVSLLRASA ASSNQTSMLI LQETCTDASG  660
AMVVYAPVDI PAMHLVMSGG DSAYVALLPS GFAILPDRSV EPHQTSGSLG SLLTVGFQIL  720
VNSQPTAKLT MESVETVNGL ISCTVQKIKA ALQCDD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009412599.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
RefseqXP_009412606.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
RefseqXP_009412616.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
RefseqXP_009412623.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
RefseqXP_009412630.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM0S1340.0M0S134_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P18760_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein